Thursday , January 18 2018
Home / Research Papers / IT/Technology / Escherichia coli plasmid ColE1, complete sequence

Escherichia coli plasmid ColE1, complete sequence

Escherichia coli plasmid ColE1, complete sequence

GenBank: J01566.1

FASTA Graphics

Go to:

LOCUS       CE1CG13                 6646 bp    DNA     circular BCT 23-JUL-2016

DEFINITION Escherichia coli plasmid ColE1, complete sequence.

ACCESSION   J01566

VERSION     J01566.1

KEYWORDS   .

SOURCE      Escherichia coli

ORGANISM Escherichia coli

Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;

Enterobacteriaceae; Escherichia.

REFERENCE   1 (bases 1008 to 1370)

AUTHORS   Tomizawa,J.I., Ohmori,H. and Bird,R.E.

TITLE     Origin of replication of colicin E1 plasmid DNA

JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 74 (5), 1865-1869 (1977)

PUBMED   325558

REFERENCE   2 (bases 1410 to 1599)

AUTHORS   Bastia,D.

TITLE     Determination of restriction sites and the nucleotide sequence

surrounding the relaxation site of ColE1

JOURNAL   J. Mol. Biol. 124 (4), 601-639 (1978)

PUBMED   712849

REFERENCE   3 (bases 1 to 1613; 6577 to 6646)

AUTHORS   Oka,A., Nomura,N., Morita,M., Sugisaki,H., Sugimoto,K. and

Takanami,M.

TITLE     Nucleotide sequence of small ColE1 derivatives: structure of the

regions essential for autonomous replication and colicin E1

immunity

JOURNAL   Mol. Gen. Genet. 172 (2), 151-159 (1979)

PUBMED   384144

REFERENCE   4 (bases 1 to 192; 384 to 519; 6644 to 6646)

AUTHORS   Patient,R.K.

TITLE     Characterization of in vitro transcription initiation and

termination sites in Col E1 DNA

JOURNAL   Nucleic Acids Res. 6 (8), 2647-2665 (1979)

PUBMED   379827

REFERENCE   5 (bases 623 to 832)

AUTHORS   Morita,M. and Oka,A.

TITLE     The structure of a transcriptional unit on colicin E1 plasmid

JOURNAL   Eur. J. Biochem. 97 (2), 435-443 (1979)

PUBMED   380993

REFERENCE   6 (bases 4783 to 5353)

AUTHORS   Ebina,Y., Kishi,F., Miki,T., Kagamiyama,H., Nakazawa,T. and

Nakazawa,A.

TITLE     The nucleotide sequence surrounding the promoter region of colicin

E1 gene

JOURNAL   Gene 15 (2-3), 119-126 (1981)

PUBMED   6271636

REFERENCE   7 (bases 639 to 753)

AUTHORS   Tomizawa,J.

TITLE     Control of ColE1 plasmid replication: the process of binding of RNA

I to the primer transcript

JOURNAL   Cell 38 (3), 861-870 (1984)

PUBMED   6207934

REFERENCE   8 (bases 1 to 6646)

AUTHORS   Chan,P.T., Ohmori,H., Tomizawa,J. and Lebowitz,J.

TITLE     Nucleotide sequence and gene organization of ColE1 DNA

JOURNAL   J. Biol. Chem. 260 (15), 8925-8935 (1985)

PUBMED   2991225

REFERENCE   9 (bases 5046 to 5110)

AUTHORS   Parker,R.C.

TITLE     Mitomycin C-induced bidirectional transcription from the colicin E1

promoter region in plasmid ColE1

JOURNAL   Biochim. Biophys. Acta 868 (1), 39-44 (1986)

PUBMED   3092859

REFERENCE   10 (bases 57 to 123)

AUTHORS   Zhang,S.P., Yan,L.F. and Zubay,G.

TITLE     Regulation of gene expression in plasmid ColE1: delayed expression

of the kil gene

JOURNAL   J. Bacteriol. 170 (12), 5460-5467 (1988)

PUBMED   3142845

REFERENCE   11 (sites)

AUTHORS   Stirling,C.J., Szatmari,G., Stewart,G., Smith,M.C. and

Sherratt,D.J.

TITLE     The arginine repressor is essential for plasmid-stabilizing

site-specific recombination at the ColE1 cer locus

JOURNAL   EMBO J. 7 (13), 4389-4395 (1988)

PUBMED   3149585

REFERENCE   12 (sites)

AUTHORS   Inoue,N. and Uchida,H.

TITLE     Transcription and initiation of ColE1 DNA replication in

Escherichia coli K-12

JOURNAL   J. Bacteriol. 173 (3), 1208-1214 (1991)

PUBMED   1846858

COMMENT     The L (light) strand is shown.  This sequence was kindly supplied

over computer network by J.Lebowitz (04-APR-1985).  The open

reading frames noted by [8] are named in FEATURES by the molecular

mass of their predicted products or by the names given by [8].

FEATURES             Location/Qualifiers

source          1..6646

/organism=”Escherichia coli”

/mol_type=”genomic DNA”

/db_xref=”taxon:562″

/clone=”pEW2762 and pMM1″

/plasmid=”ColE1″

mRNA            join (5056..6646,1..>585)

/product=”colE1-kil mRNA”

/citation= [8]

CDS             join (5140..6646,1..62)

/codon_start=1

/transl_table=11

/product=”colicin E1 protein (cea)”

/protein_id=”AAB59121.1″

/translation=”METAVAYYKDGVPYDDKGQVIITLLNGTPDGSGSGGGGGKGGSK

SESSAAIHATAKWSTAQLKKTQAEQAARAKAAAEAQAKAKANRDALTQRLKDIVNEAL

RHNASRTPSATELAHANNAAMQAEAERLRLAKAEEKARKEAEAAEKAFQEAEQRRKEI

EREKAETERQLKLAEAEEKRLAALSEEAKAVEIAQKKLSAAQSEVVKMDGEIKTLNSR

LSSSIHARDAEMKTLAGKRNELAQASAKYKELDELVKKLSPRANDPLQNRPFFEATRR

RVGAGKIREEKQKQVTASETRINRINADITQIQKAISQVSNNRNAGIARVHEAEENLK

KAQNNLLNSQIKDAVDATVSFYQTLTEKYGEKYSKMAQELADKSKGKKIGNVNEALAA

FEKYKDVLNKKFSKADRDAIFNALASVKYDDWAKHLDQFAKYLKITGHVSFGYDVVSD

ILKIKDTGDWKPLFLTLEKKAADAGVSYVVALLFSLLAGTTLGIWGIAIVTGILCSYI

DKNKLNTINEVLGI”

mRNA            complement (<59..409)

/note=”imm mRNA [5], [8]”

CDS             complement (59.400)

/codon_start=1

/transl_table=11

/product=”colicin E1 immunity protein (imm)”

/protein_id=”AAB59122.1″

/translation=”MSLRYYIKNILFGLYCTLIYIYLITKNSEGYYFLVSDKMLYAIV

ISTILCPYSKYAIEYIAFNFIKKDFFERRKNLNNAPVAKLNLFMLYNLLCLVLAIPFG

LLGLFISIKNN”

misc_difference 83.84

/note=”conflict”

/citation= [4]

/replace=””

misc_difference 99.100

/note=”conflict”

/citation= [4]

/replace=””

     misc_difference 135

/note=”conflict; replace 133..133 in Nucleic Acids Res. 6,

2647-2665 (1979)”

/citation= [4]

/replace=””

misc_difference 144

/note=”conflict; replace 142..142 in Nucleic Acids Res. 6,

2647-2665 (1979)”

/citation= [4]

/replace=””

misc_difference 174

/note=”conflict; replace 172..172 in Nucleic Acids Res. 6,

2647-2665 (1979)”

/citation=[4]

/replace=””

CDS             448..585

/codon_start=1

/transl_table=11

/product=”kil protein”

/protein_id=”AAB59123.1″

/translation=”MRKRFFVGIFAINLLVGCQANYIPDVQGGTIAPSSSSKLTGIAV

Q”

misc_difference 484..485

/note=”conflict; replace 101 in Nucleic Acids Res. 6,

2647-2665 (1979)”

/citation= [4]

/replace=””

     misc_difference 491..492

/note=”conflict; replace 107 in Nucleic Acids Res. 6,

2647-2665 (1979)”

/citation= [4]

/replace=””

misc_difference 506..512

/note=”conflict; replace 121 in Nucleic Acids Res. 6,

2647-2665 (1979)”

/citation= [4]

/replace=””

misc_difference 517..519

/note=”conflict; replace 121..131 in Nucleic Acids Res. 6,

2647-2665 (1979)”

/citation= [4]

/replace=””

     misc_difference 528

/note=”conflict; replace 528 in J. Biol. Chem. 260,

8925-8935 (1985)”

/citation=[8]

/replace=””

CDS             605..895

/citation= [8]

/codon_start=1

/transl_table=11

/product=”10.2 kd ORF”

/protein_id=”AAB59124.1″

/translation=”MRSFFSARNLLLANKKTTATNGGLFAGSRATNSFSEGNWLQQSA

DTKYCPSSVAVVGPLLQELCSTVCAIIALLIRLPVAAASGVKACLTGLDSRR”

misc_RNA        641.>641

/note=”II RNA”

misc_RNA        complement (645.751)

/note=”I RNA ((3′ end +/- 1 bp) [3]”

misc_difference 652.653

/note=”conflict; replace 31.32 in Eur. J. Biochem. 97,

435-443 (1979)”

/citation= [5]

/replace=””

ORIGIN   

1 ttctatgctc ctatattgat aagaataaac ttaatactat aaatgaggtg ttagggattt

61 aattattctt tattgatata aaaagtccta gcaatccaaa tgggattgct aggaccaaac

121 aaagtagatt atatagcata aataggttta attttgctac gggggcgtta tttaggtttt

181 ttcttctttc gaaaaaatct ttctttatga agttaaaagc tatgtattca atagcatatt

241 ttgaatatgg acatagaata gtgcttatca ctattgcata tagcatctta tctgacacaa

301 ggaaataata cccttcgctg ttttttgtta taaggtatat atatataagt gtgcagtaca

361 ggccaaataa aatatttttt atgtagtatc ttaagctcat aaattaaacc tcgccatata

421 ttcttttcat tttataagga tcgagttatg aggaaaagat tttttgtggg aatattcgcg

481 ataaacctcc ttgttggatg tcaggctaac tatatacctg atgttcaggg agggaccatc

541 gcaccatcct cctcttctaa actgacgggg atcgcggttc agtagaaaag attaaaggat

601 cttcttgaga tccttttttt ctgcgcgtaa tctgctgctt gcaaacaaaa aaaccaccgc

661 taccaacggt ggtttgtttg ccggatcaag agctaccaac tctttttccg aaggtaactg

721 gcttcagcag agcgcagata ccaaatactg tccttctagt gtagccgtag tcgggccact

781 acttcaagaa ctctgtagca ccgtttgtgc catcatcgct ctgctaatcc ggttaccagt

841 ggctgctgcc agtggcgtta aggcgtgcct taccgggttg gactcaagac gatagttacc

901 ggataaggcg cagcggtcgg gctgaacggg gggttcgtgc acacagccca gcttggagcg

961 aacgacctac accgaactga gataccaaca gcgtgagcta tgagaaagcg ccacgcttcc

1021 cgaagggaga aaggcggaca ggtatccggt aagcggcagg gtcggaacag gagagcgcac

1081 gagggagctt ccagggggaa acgcctggta gctttatagt cctgtcgggt ttcgccacct

1141 ctgacttgag cgtctatttt tgtgatgctc gtcagggggg cggagcctat ggaaaaacgc

1201 ctgctacgtg gccttcttcc tgttcctggt cttttgctca catgttcttt ccggccttat

1261 cccctgattc tgtggataac tgtgttaccg tttttgtgtg agtcagtacc gctcgccgca

1321 gtcgaacgac cgagcgtagc gagtcagtga gcgaggaagc ggaaaagcgc ctggacgtgc

1381 attttctcct tacgcatctg tgcggcattt cacacccggc atggcgtact tttcatacaa

1441 tccgcactga tgccgcatgg ttaagccagt atacactccg ctatcgctac gtgactgggt

1501 cagggctgcg ccccgacacc cgctaaaacc tgctgacgcg ccctgacggg cttgtcagct

1561 cccggcatcc gctcacagac aagctgtgac cgtctccggg agctgcatgt gtcagaggtt

1621 ttcaccgtca tccccgaaac gtgcgaggca gctgcggtaa agctcatcgg cgtggtcgtg

1681 aagcgattca caaatatcgg cctgttcatc tgcgtccagt tcgttgagct tctccagcag

1741 cgttaatgtc tggcttctga taaagcgggc catgttaagg gcggtttttt cctgtttagt

1801 cactgatgcc tccgtgtaag ggggatttct gttcatgggg taatgatacc gatgaaacgc

1861 gagaggatgc tcacaatacg ggttactgat gatgaacatg cccggttact tgaacgctgt

1921 gagggtaaac aactggcggt atggatgcgg cgggtctgcc tgggggagcc ggttgcccgt

1981 tccggaaaac tgccgacact ggcaccgccg ttactgcgtc agctggccgc catcggaaat

2041 aacctgaatc agacagcccg taaggtgaac agcgggcagt ggtcttccgg tgaccgggtt

2101 caggtggtgg ccgcactgat ggccatcggg gatgagctgc gccggctgcg tctggctgtc

2161 agggaacagg gggcgcggga tgatagttaa atttcatgcc aggggaaaag gtggtggcag

2221 tggtccggtt gattacctgc tggggaggga gcgtaaccgc gaaggcgcaa cggtgcttca

2281 gggtataccg gaagaagtcc gggaactcat cgatgccacg ccatttgcga agaaatacac

2341 gtccggtgtt ctgtcgttcg cggagaagga gctgccgccg ggaggacgtg aaaaagtgat

2401 ggcgagcttt gagcgtgtac tgatgcccgg tctcgaaaaa aatcagtaca gcatcctgtg

2461 ggtggagcac caggacaagg gacggcttga gctgaatttt gtcattccga acatggagct

2521 acagaccgga aaacgcctcc agccgtacta cgaccgcgca gacaggccta gaattgatgc

2581 ttggcagacg ctgttaaatc accattacgg gctgcatgac ccgaacgccc cggagaaccg

2641 caggacgctg acactccctg ataacctgcc tgaaacgaaa caggcgcttg ctgagggcgt

2701 cacgcgaggt atagatgcac tttaccatgc cggagagata aaaggccgtc aggatgtgat

2761 tcaggcgctc actgaggcgg ggctggaagt ggtcagggtg acgcgaagca gtatcagcat

2821 tgcagatccg aacggcggga agaatatcag gctgaaagga gcattttatg agcaatcttt

2881 tgcagacggg cgcggagttc gagaaaaagc tgaaagagag agccgaatct acagagaaaa

2941 tgctgaacaa cgagttcagg aggctcggcg aatctgtaag cgaggctgtg acatcaaacg

3001 agacgaaaat cagagacgct atagccctgt tcacagcctc gacagaggaa tcgctggaaa

3061 aacaccggga aggggtgaaa gaggcgatga tgcagcacag gagggacgtg ttaaagctgg

3121 cagggaatac gggcatgatg ttactgggga tagtctttct cctgtttacc gcgagtggcg

3181 ggacgctctg gtatcttgga gggaggatac aggcgaacct ggaagaaatc aggaagcagg

3241 aagagacatt gcagaaactg aacgcgaaga catggggcgt ggagtttgtg caggacggga

3301 acaggaaatt ccttgtcctt ccgtacggga aatcagcgga ggtgattccc tttcagggga

3361 aagagtgggt acatctgaag gagtgacaca gagtgacaga gctggaaaca catttgctga

3421 acgccttaga gcagctgcaa caggactata tgcagcggct gagcgaatgg gagagcgcct

3481 tcgtggaatt gcagaagatg ttttcgctta cgcaacggga caacgcgatg ctgaacgagc

3541 gggtcatgca gttgagtcag caggtgcaac acttgagcga gcagacagaa cgcttgagcc

3601 agttatacag cgagaactgg agataagaga ggaacggctg atacaggagc gcgaacatgt

3661 gttatcccta gaacgggagc gtcagccgga aatacaggaa cgcacgctgg atggcccttc

3721 gctgggatgg tgaaaccatg aaaaatggca gcttcagtgg attaagtggg ggtaatgtgg

3781 cctgtaccct ctggttgcat aggtattcat acggttaaaa tttatcaggc gcgatcgcgc

3841 agtttttagg gtggtttgtt gccattttta cctgtctgct gccgtgatcg cgctgaacgc

3901 gttttagcgg tgcgtacaat taagggatta tggtaaatcc acttactgtc tgccctcgta

3961 gccatcgaga taaaccgcag aaatcgtgtc agccagcagc ctggattttt tcggggtaag

4021 gtctttgctg cggtaatcag tacccgcaaa ttgagttgtg ccccggagtg agtttaaaaa

4081 ttcttggctg tgaaactgct gaatgcgttg ttgcacatca ctccgtgatt ttcctgtcgc

4141 tttgtcttta gctcccatat cccagaactg ccgaaaaaaa ggcaccatca ttcgtgttgt

4201 gtcggctttt tgggtggaaa agttgggatc aaaaccgtca tcagaagcat atacgtaatg

4261 ccgggtatgt tgttccacgc tgccctttgg ggtacaggct gtgagagcta ctgttgctgt

4321 tatcatggcg ataagacaaa gtttgtttcc ggtacgtctc atgagtgtct ccctacctta

4381 aagtatttat tctcggtgag ttattatccg aagactattt tatcatcagt ctctgacagc

4441 gttcagcgac cgaacaacct ggaccagaat ccccgtttct tttccagttc cagtgcctgc

4501 ctgagctggg ctatctcatt ttgtagctgt tcccgttctg cttcctggcg tctgcgatcc

4561 atatcctgtg cctgtttatc ctcaagcatc agcgtcaggc attgtttcag ctcattcagt

4621 tcccggagaa tgcgttctgt ctgctgatca tgtggatttt ctgcatgtcc ctcactgtgc

4681 ctttctggtg tctcattctg ctttaattcg ccgtatgccc ggatcagttc actggtttca

4741 aactcccgtc gtccgtccct gccggtacgg taactgacaa ggcctccgcg catatcacgg

4801 taaaactgtg aacgcgatct gcctgtcatt tttagtgcgt cccggagtgt gtgccatgcc

4861 ataaagtgac agtgtcccat agatgtctca tctcatagtt tcagtaaaac ataatgaggt

4921 ctgagaacgg taatgtttgt gctggttttt gtggcatcgg gcgagaatag cgcgtggtgt

4981 gaaagactgt ttttttgatc gttttcacaa aaatggaagt ccacagtctt gacagggaaa

5041 atgcagcggc gtagctttta tgctgtatat aaaaccagtg gttatatgta cagtatttat

5101 ttttaactta ttgttttaaa agtcaaagag gattttataa tggaaaccgc ggtagcgtac

5161 tataaagatg gtgttcctta tgatgataag ggacaggtaa ttattactct tttgaatggt

5221 actcctgacg ggagtggctc tggcggcgga ggtggaaaag gaggcagtaa aagtgaaagt

5281 tctgcagcta ttcatgcaac tgctaaatgg tctactgctc aattaaagaa aacacaggca

5341 gagcaggctg cccgggcaaa agctgcagcg gaagcacagg cgaaagcaaa ggcaaacagg

5401 gatgcgctga ctcagcgcct gaaggatatc gtgaatgagg ctcttcgtca caatgcctca

5461 cgtacgcctt cagcaacaga gcttgctcat gctaataatg cagctatgca ggcggaagca

5521 gagcgtttgc gccttgcgaa agcagaagaa aaagcccgta aagaagcgga agcagcagaa

5581 aaggcttttc aggaagcaga acaacgacgt aaagagattg aacgggagaa ggctgaaaca

5641 gaacgccagt tgaaactggc tgaagctgaa gagaaacgac tggctgcatt gagtgaagaa

5701 gctaaagctg ttgagatcgc ccaaaaaaaa ctttctgctg cacaatctga agtggtgaaa

5761 atggatggag agattaagac tctcaattct cgtttaagct ccagtatcca tgcccgtgat

5821 gcagaaatga aaacgctcgc tggaaaacga aatgaactgg ctcaggcatc cgctaaatat

5881 aaagaactgg atgagctggt caaaaaacta tcaccaagag ccaatgatcc gcttcagaac

5941 cgtccttttt ttgaagcaac cagacgacgg gttggggccg gtaagattag agaagaaaaa

6001 caaaaacagg taacagcatc agaaacacgt attaaccgga taaatgctga tataactcag

6061 atccagaagg ctatttctca ggtcagtaat aatcgtaatg ccggtatcgc tcgtgttcat

6121 gaagctgaag aaaatttgaa aaaagcacag aataatctcc ttaattcaca gattaaggat

6181 gctgttgatg caacagttag cttttatcaa acgctgactg aaaaatatgg tgaaaaatat

6241 tcgaaaatgg cacaggaact tgctgataag tctaaaggta agaaaatcgg caatgtgaat

6301 gaagctctcg ctgcttttga aaaatacaag gatgttttaa ataagaaatt cagcaaagcc

6361 gatcgtgatg ctatttttaa tgcgttggca tcggtgaagt atgatgactg ggctaaacat

6421 ttagatcagt ttgccaagta cttgaagatt acggggcatg tttcttttgg atatgatgtg

6481 gtatctgata tcctaaaaat taaggataca ggtgactgga agccactatt tcttacatta

6541 gagaagaaag ctgcagatgc aggggtgagt tatgttgttg ctttactttt tagcttgctt

6601 gctggaacta cattaggtat ttggggtatt gctattgtta caggaa

Leave a Reply

Your email address will not be published. Required fields are marked *